PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_08538_BGI-A2_v1.0
Common NameF383_22909
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 331aa    MW: 36569.8 Da    PI: 8.1566
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_08538_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.32.3e-32184240158
                   CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                                 dep+YVNaKQyq+Il+RRq Rakle+++kl +k rkpylheSRh hAl+R+Rg+gGrF
  Cotton_A_08538_BGI-A2_v1.0 184 DEPIYVNAKQYQAILRRRQYRAKLEAQNKL-IKVRKPYLHESRHLHALKRARGNGGRF 240
                                 79****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005216.8E-37182243IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.096183243IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.4E-26185240IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006167.1E-23186208IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860188208IPR018362CCAAT-binding factor, conserved site
PRINTSPR006167.1E-23217240IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MQNKKDSTVS SHSMSTYVVG CSSWENSTES HVQHSSISEN LSLKMGLLPQ YLNNNKQLSF  60
QFQDQDSSST QSTCQSCPEV ASAGDSNLYE QSLISASSGG NEMHGKLVGD YTKLATSMGT  120
QECVLPPSQV DYSKSIAHIP LHYADPYFGG VVASAYTPQA MIHHQRTMAM LPARVPLPLE  180
LTQDEPIYVN AKQYQAILRR RQYRAKLEAQ NKLIKVRKPY LHESRHLHAL KRARGNGGRF  240
LNTKKLQESK GITTSNGLDT YFKSEVHQLE NYKDAASTAS CSDVTTASNS DEIFQQADFR  300
FSTYSSHIGG PMPAHTGDMQ GGGNLHHRLC G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-19184245263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012454937.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
TrEMBLA0A0B0MMA90.0A0A0B0MMA9_G
STRINGGLYMA07G04050.56e-98(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33492762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.16e-78nuclear factor Y, subunit A3